PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g021378m
Common NameCISIN_1g021378mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family B3
Protein Properties Length: 314aa    MW: 36222.6 Da    PI: 6.6285
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g021378mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B346.56.4e-1518102898
                        -HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                 B3   8 sdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                        +++  +++l++p kf+ ++g +   s   +l  ++gr+W+v l  +k ++++++ +GW++Fv+++ + +g f++Fk++++s f  +v +f+
  orange1.1g021378m  18 PSTIHNKMLRIPLKFVGQFGDE--LSSIAKLAVPDGRVWQVGL--TKFGRKIWFDQGWQNFVESQSISAGYFLLFKYEKNSIF--RVLIFD 102
                        66778889********999755..7779***************..********************************999999..888886 PP

2B342.41.3e-132172931796
                        E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                 B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                        + p +fa ++  + e sk + ++ +sgr+W++ + +++  g+++l+kGW +  +  +L egD+++F+l+++++  ++++v
  orange1.1g021378m 217 YAPARFAYQY--VDEDSKSVEVQAPSGRKWSLGI-HWRATGGFFLAKGWAGVSDYVHLTEGDICIFELVRHRDVVFKLHV 293
                        6688998666..4557889***************.7888899*************************9976655455555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.1E-225106IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.73E-2110106IPR015300DNA-binding pseudobarrel domain
CDDcd100174.08E-1410102No hitNo description
PROSITE profilePS5086313.28111104IPR003340B3 DNA binding domain
SMARTSM010192.3E-1312104IPR003340B3 DNA binding domain
PfamPF023624.2E-1315102IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.9E-13197295IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.1E-14198295IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.11201297IPR003340B3 DNA binding domain
PfamPF023621.8E-11215294IPR003340B3 DNA binding domain
CDDcd100175.44E-10219294No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MSSSAAETSS MFYSMILPST IHNKMLRIPL KFVGQFGDEL SSIAKLAVPD GRVWQVGLTK  60
FGRKIWFDQG WQNFVESQSI SAGYFLLFKY EKNSIFRVLI FDMTACEIDY PYEDDMACEM  120
CVEISEEQFK HEAELLSRKR KMEDGLERDE PNAEPDLLVS LRKSGIYITE KYKELYSTEE  180
LERAVYIARA FKATNPKPNP LFMIIWKAND KPCREVYAPA RFAYQYVDED SKSVEVQAPS  240
GRKWSLGIHW RATGGFFLAK GWAGVSDYVH LTEGDICIFE LVRHRDVVFK LHVFHQCSKI  300
TSWREKFSLV SII*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136141SRKRKM
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.104890.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015388635.10.0PREDICTED: B3 domain-containing transcription factor VRN1-like
TrEMBLA0A067DEF90.0A0A067DEF9_CITSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15912578
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.13e-37B3 family protein